SCOPe 2.08: Domain d1g4cb_: 1g4c B:

Lineage for d1g4cb_ (1g4c B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
   Uniprot P26281

8. Domain d1g4cb_: 1g4c B: [83271]
   complexed with cl, mg

Details for d1g4cb_

PDB Entry: 1g4c, 1.65 Å

PDB Description: crystal structure of a complex of hppk(r92a) from e.coli with mg2+ at 1.65 angstrom resolution

PDB Compounds: (B:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase

SCOPe Domain Sequences for d1g4cb_:

Sequence; same for both SEQRES and ATOM records:

>d1g4cb_ d.58.30.1 (B:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d1g4cb_:

• d1g4cb_ first appeared in SCOP 1.65
  
• d1g4cb_ appears in SCOPe 2.07