Lineage for d1g2xc_ (1g2x C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733143Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
    Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity
  8. 2733154Domain d1g2xc_: 1g2x C: [83267]
    trimeric isoform

Details for d1g2xc_

PDB Entry: 1g2x (more details), 2.5 Å

PDB Description: sequence induced trimerization of krait pla2: crystal structure of the trimeric form of krait pla2
PDB Compounds: (C:) phospholipase a2

SCOPe Domain Sequences for d1g2xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2xc_ a.133.1.2 (C:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

SCOPe Domain Coordinates for d1g2xc_:

Click to download the PDB-style file with coordinates for d1g2xc_.
(The format of our PDB-style files is described here.)

Timeline for d1g2xc_: