Lineage for d1g2xa_ (1g2x A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449193Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
  8. 449200Domain d1g2xa_: 1g2x A: [83265]

Details for d1g2xa_

PDB Entry: 1g2x (more details), 2.5 Å

PDB Description: sequence induced trimerization of krait pla2: crystal structure of the trimeric form of krait pla2

SCOP Domain Sequences for d1g2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2xa_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq

SCOP Domain Coordinates for d1g2xa_:

Click to download the PDB-style file with coordinates for d1g2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1g2xa_: