| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (35 species) |
| Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries) |
| Domain d1g2xa_: 1g2x A: [83265] |
PDB Entry: 1g2x (more details), 2.5 Å
SCOP Domain Sequences for d1g2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2xa_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq
Timeline for d1g2xa_: