Lineage for d1g0zb_ (1g0z B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346181Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
    Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity
  8. 2346184Domain d1g0zb_: 1g0z B: [83264]
    complexed with cl; mutant

Details for d1g0zb_

PDB Entry: 1g0z (more details), 2.18 Å

PDB Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1g0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0zb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

SCOPe Domain Coordinates for d1g0zb_:

Click to download the PDB-style file with coordinates for d1g0zb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0zb_: