SCOP 1.71: Domain d1g0zb_: 1g0z B:

Lineage for d1g0zb_ (1g0z B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)

8. Domain d1g0zb_: 1g0z B: [83264]
   complexed with cl; mutant

Details for d1g0zb_

PDB Entry: 1g0z, 2.18 Å

PDB Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution

SCOP Domain Sequences for d1g0zb_:

Sequence; same for both SEQRES and ATOM records:

>d1g0zb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

Timeline for d1g0zb_:

• d1g0zb_ first appeared in SCOP 1.65
  
• d1g0zb_ appears in SCOP 1.69
  
• d1g0zb_ appears in SCOP 1.73
  
• d1g0zb_ appears in the current release, SCOPe 2.08