Lineage for d1g0zb_ (1g0z B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286190Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (4 PDB entries)
  8. 286192Domain d1g0zb_: 1g0z B: [83264]
    complexed with cl; mutant

Details for d1g0zb_

PDB Entry: 1g0z (more details), 2.18 Å

PDB Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution

SCOP Domain Sequences for d1g0zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g0zb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

SCOP Domain Coordinates for d1g0zb_:

Click to download the PDB-style file with coordinates for d1g0zb_.
(The format of our PDB-style files is described here.)

Timeline for d1g0zb_: