SCOPe 2.07: Domain d1g0za_: 1g0z A:

Lineage for d1g0za_ (1g0z A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
   Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity

8. Domain d1g0za_: 1g0z A: [83263]
   complexed with cl; mutant

Details for d1g0za_

PDB Entry: 1g0z, 2.18 Å

PDB Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1g0za_:

Sequence; same for both SEQRES and ATOM records:

>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

Timeline for d1g0za_:

• d1g0za_ first appeared in SCOP 1.65
  
• d1g0za_ appears in SCOPe 2.06
  
• d1g0za_ appears in the current release, SCOPe 2.08