SCOP 1.65: Domain d1g0za_: 1g0z A:

Lineage for d1g0za_ (1g0z A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulphide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (27 species)

7. Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (4 PDB entries)

8. Domain d1g0za_: 1g0z A: [83263]

Details for d1g0za_

PDB Entry: 1g0z, 2.18 Å

PDB Description: specific mutations in krait pla2 lead to dimerization of protein molecules: crystal structure of krait pla2 at 2.1 resolution

SCOP Domain Sequences for d1g0za_:

Sequence; same for both SEQRES and ATOM records:

>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nlkqfknmiqcagtrtwtsyigygcycgyggsgtpvdeldrccythdhcynkaanipgcn
pliktysytctkpnitcndtsdscarficdcdrtaaicfasapyninnimisastscq

Timeline for d1g0za_:

• d1g0za_ is new in SCOP 1.65
  
• d1g0za_ appears in SCOP 1.67
  
• d1g0za_ appears in the current release, SCOPe 2.08