Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (5 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.1: HNH-motif [54061] (2 proteins) |
Protein DNase domain of colicin E9 [54064] (1 species) |
Species Escherichia coli [TaxId:562] [54065] (4 PDB entries) |
Domain d1fsje_: 1fsj E: [83261] complexed with po4, zn |
PDB Entry: 1fsj (more details), 1.8 Å
SCOP Domain Sequences for d1fsje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsje_ d.4.1.1 (E:) DNase domain of colicin E9 {Escherichia coli} skrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevs kdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhhdkpisqggevydmdnirvt tpkrhidihrgk
Timeline for d1fsje_: