Lineage for d1fr2a_ (1fr2 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487541Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
    automatically mapped to Pfam PF01320
  5. 1487542Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1487566Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 1487567Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)
  8. 1487575Domain d1fr2a_: 1fr2 A: [83256]
    Other proteins in same PDB: d1fr2b_
    protein/DNA complex; complexed with po4, zn; mutant

Details for d1fr2a_

PDB Entry: 1fr2 (more details), 1.6 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9(e41a)
PDB Compounds: (A:) colicin e9 immunity protein

SCOPe Domain Sequences for d1fr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fr2a_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfaemtehpsgsdliyypkegddd
spsgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d1fr2a_:

Click to download the PDB-style file with coordinates for d1fr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1fr2a_: