Class a: All alpha proteins [46456] (179 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) |
Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) |
Protein ImmE9 protein (Im9) [47351] (1 species) |
Species Escherichia coli [TaxId:562] [47352] (6 PDB entries) |
Domain d1fr2a_: 1fr2 A: [83256] Other proteins in same PDB: d1fr2b_ complexed with po4, zn; mutant |
PDB Entry: 1fr2 (more details), 1.6 Å
SCOP Domain Sequences for d1fr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fr2a_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli} lkhsisdyteaeflqlvtticnadtsseeelvklvthfaemtehpsgsdliyypkegddd spsgivntvkqwraangksgfkq
Timeline for d1fr2a_: