SCOP 1.69: Domain d1fnxh2: 1fnx H:121-208

Lineage for d1fnxh2 (1fnx H:121-208)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (20 proteins)

6. Protein Hu antigen C (Huc) [54940] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [54941] (3 PDB entries)

8. Domain d1fnxh2: 1fnx H:121-208 [83254]

Details for d1fnxh2

PDB Entry: 1fnx

PDB Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element

SCOP Domain Sequences for d1fnxh2:

Sequence; same for both SEQRES and ATOM records:

>d1fnxh2 d.58.7.1 (H:121-208) Hu antigen C (Huc) {Mouse (Mus musculus)}
sirdanlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieae
eaikglngqkplgaaepitvkfannpsq

Timeline for d1fnxh2:

• d1fnxh2 first appeared in SCOP 1.65
  
• d1fnxh2 appears in SCOP 1.67
  
• d1fnxh2 appears in SCOP 1.71
  
• d1fnxh2 appears in the current release, SCOPe 2.08