Lineage for d1fnxh2 (1fnx H:121-208)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412370Protein Hu antigen C (Huc) [54940] (1 species)
  7. 412371Species Mouse (Mus musculus) [TaxId:10090] [54941] (3 PDB entries)
  8. 412375Domain d1fnxh2: 1fnx H:121-208 [83254]

Details for d1fnxh2

PDB Entry: 1fnx (more details)

PDB Description: solution structure of the huc rbd1-rbd2 complexed with the au-rich element

SCOP Domain Sequences for d1fnxh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnxh2 d.58.7.1 (H:121-208) Hu antigen C (Huc) {Mouse (Mus musculus)}
sirdanlyvsglpktmsqkemeqlfsqygriitsrilldqatgvsrgvgfirfdkrieae
eaikglngqkplgaaepitvkfannpsq

SCOP Domain Coordinates for d1fnxh2:

Click to download the PDB-style file with coordinates for d1fnxh2.
(The format of our PDB-style files is described here.)

Timeline for d1fnxh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnxh1