SCOPe 2.06: Domain d1fhla_: 1fhl A:

Lineage for d1fhla_ (1fhl A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-1,4-galactanase [89469] (4 species)

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [89470] (2 PDB entries)

8. Domain d1fhla_: 1fhl A: [83252]

Details for d1fhla_

PDB Entry: 1fhl, 2.3 Å

PDB Description: crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k

PDB Compounds: (A:) beta-1,4-galactanase

SCOPe Domain Sequences for d1fhla_:

Sequence; same for both SEQRES and ATOM records:

>d1fhla_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
altyrgadisslllledegysyknlngqtqaletiladaginsirqrvwvnpsdgsydld
ynlelakrvkaagmslyldlhlsdtwadpsdqttpsgwsttdlgtlkwqlynytlevcnt
faendidieiisigneiragllwplgetssysnigallhsgawgvkdsnlattpkimihl
ddgwswdqqnyfyetvlatgellstdfdyfgvsyypfysasatlaslktslanlqstydk
pvvvvetnwpvscpnpayafpsdlssipfsvagqqefleklaavveattdglgvyywepa
wignaglgsscadnlmvdyttdevyesietlgel

Timeline for d1fhla_:

• d1fhla_ first appeared in SCOP 1.65
  
• d1fhla_ appears in SCOPe 2.05
  
• d1fhla_ appears in SCOPe 2.07
  
• d1fhla_ appears in the current release, SCOPe 2.08