Lineage for d1fb9a_ (1fb9 A:)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 899306Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 899307Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 899308Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 899309Protein Calcitonin [58301] (3 species)
  7. 899317Species Pink salmon (Oncorhynchus gorbuscha) [TaxId:8017] [90268] (1 PDB entry)
  8. 899318Domain d1fb9a_: 1fb9 A: [83250]

Details for d1fb9a_

PDB Entry: 1fb9 (more details)

PDB Description: effects of s-sulfonation on the solution structure of salmon calcitonin
PDB Compounds: (A:) calcitonin analogue

SCOP Domain Sequences for d1fb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb9a_ j.6.1.1 (A:) Calcitonin {Pink salmon (Oncorhynchus gorbuscha) [TaxId: 8017]}
csnlstcvlgklsqelhklqtyprtntgsgtp

SCOP Domain Coordinates for d1fb9a_:

Click to download the PDB-style file with coordinates for d1fb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fb9a_: