SCOP 1.75: Domain d1f54a_: 1f54 A:

Lineage for d1f54a_ (1f54 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (11 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89052] (3 PDB entries)

8. Domain d1f54a_: 1f54 A: [83244]
   N-terminal domain, apo form

Details for d1f54a_

PDB Entry: 1f54

PDB Description: solution structure of the apo n-terminal domain of yeast calmodulin

PDB Compounds: (A:) calmodulin

SCOP Domain Sequences for d1f54a_:

Sequence; same for both SEQRES and ATOM records:

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlk

Timeline for d1f54a_:

• d1f54a_ first appeared in SCOP 1.65
  
• d1f54a_ appears in SCOP 1.73
  
• d1f54a_ appears in SCOPe 2.01
  
• d1f54a_ appears in the current release, SCOPe 2.08