![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
![]() | Species Brevibacterium fuscum [TaxId:47914] [89888] (3 PDB entries) |
![]() | Domain d1f1xd2: 1f1x D:148-322 [83215] complexed with fel |
PDB Entry: 1f1x (more details), 1.6 Å
SCOP Domain Sequences for d1f1xd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1xd2 d.32.1.3 (D:148-322) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum} gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeii
Timeline for d1f1xd2: