Lineage for d1f1xb1 (1f1x B:4-147)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. Domain d1f1xb1: 1f1x B:4-147 [83210]
    complexed with fel

Details for d1f1xb1

PDB Entry: 1f1x (more details), 1.6 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum
PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d1f1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1xb1 d.32.1.3 (B:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn
lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg
fpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d1f1xb1 are not available.

Timeline for d1f1xb1:

Domains from same chain:
(mouse over for more information)
d1f1xb2
Domains from other chains:
(mouse over for more information)
d1f1xa1, d1f1xa2, d1f1xc1, d1f1xc2, d1f1xd1, d1f1xd2