Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
Species Arthrobacter globiformis [TaxId:1665] [89887] (3 PDB entries) |
Domain d1f1rb1: 1f1r B:3-147 [83198] complexed with mn |
PDB Entry: 1f1r (more details), 1.8 Å
SCOPe Domain Sequences for d1f1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1rb1 d.32.1.3 (B:3-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} nfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihh nlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedpl gfpyeffyetehverltqrydlysa
Timeline for d1f1rb1: