SCOP 1.65: Domain d1f1rb1: 1f1r B:3-147

Lineage for d1f1rb1 (1f1r B:3-147)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)

7. Species Arthrobacter globiformis [TaxId:1665] [89887] (3 PDB entries)

8. Domain d1f1rb1: 1f1r B:3-147 [83198]

Details for d1f1rb1

PDB Entry: 1f1r, 1.8 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, non-cryo)

SCOP Domain Sequences for d1f1rb1:

Sequence; same for both SEQRES and ATOM records:

>d1f1rb1 d.32.1.3 (B:3-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis}
nfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihh
nlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedpl
gfpyeffyetehverltqrydlysa

Timeline for d1f1rb1:

• d1f1rb1 is new in SCOP 1.65
  
• d1f1rb1 appears in SCOP 1.67
  
• d1f1rb1 appears in the current release, SCOPe 2.08