Lineage for d1f1ra1 (1f1r A:3-147)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502320Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 502403Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 502404Species Arthrobacter globiformis [TaxId:1665] [89887] (3 PDB entries)
  8. 502413Domain d1f1ra1: 1f1r A:3-147 [83196]

Details for d1f1ra1

PDB Entry: 1f1r (more details), 1.8 Å

PDB Description: crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, non-cryo)

SCOP Domain Sequences for d1f1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1ra1 d.32.1.3 (A:3-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis}
nfvptpsvpapdivrcaymeivvtdlaksrefyvdvlglhvteedentiylrsleefihh
nlvlrqgpiaavaafayrvkspaevdaaeayykelgcrterrkegftkgigdsvrvedpl
gfpyeffyetehverltqrydlysa

SCOP Domain Coordinates for d1f1ra1:

Click to download the PDB-style file with coordinates for d1f1ra1.
(The format of our PDB-style files is described here.)

Timeline for d1f1ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1ra2