Lineage for d1ewoa_ (1ewo A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324261Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 324262Superfamily d.3.1: Cysteine proteinases [54001] (9 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 324263Family d.3.1.1: Papain-like [54002] (20 proteins)
  6. 324379Protein Cruzain [54020] (1 species)
  7. 324380Species Trypanosoma cruzi [TaxId:5693] [54021] (12 PDB entries)
  8. 324394Domain d1ewoa_: 1ewo A: [83195]
    complexed with vsc

Details for d1ewoa_

PDB Entry: 1ewo (more details), 2.1 Å

PDB Description: the cysteine protease cruzain bound to wrr-204

SCOP Domain Sequences for d1ewoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewoa_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOP Domain Coordinates for d1ewoa_:

Click to download the PDB-style file with coordinates for d1ewoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ewoa_: