Lineage for d1ewma_ (1ewm A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173269Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2173480Protein Cruzain [54020] (1 species)
  7. 2173481Species Trypanosoma cruzi [TaxId:5693] [54021] (25 PDB entries)
  8. 2173500Domain d1ewma_: 1ewm A: [83194]
    complexed with rl2

Details for d1ewma_

PDB Entry: 1ewm (more details), 2 Å

PDB Description: the cysteine protease cruzain bound to wrr-112
PDB Compounds: (A:) cruzain

SCOPe Domain Sequences for d1ewma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewma_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOPe Domain Coordinates for d1ewma_:

Click to download the PDB-style file with coordinates for d1ewma_.
(The format of our PDB-style files is described here.)

Timeline for d1ewma_: