Lineage for d1ewla_ (1ewl A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. Protein Cruzain [54020] (1 species)
  7. Species Trypanosoma cruzi [TaxId:5693] [54021] (28 PDB entries)
  8. Domain d1ewla_: 1ewl A: [83193]
    complexed with r99

Details for d1ewla_

PDB Entry: 1ewl (more details), 2 Å

PDB Description: crystal structure of cruzain bound to wrr-99
PDB Compounds: (A:) cruzain

SCOPe Domain Sequences for d1ewla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewla_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOPe Domain Coordinates for d1ewla_ are not available.

Timeline for d1ewla_: