Lineage for d1ep6c_ (1ep6 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 466199Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 466239Protein Viral capsid protein [50597] (3 species)
  7. 466262Species Venezuelan equine encephalitis virus [TaxId:11036] [89347] (2 PDB entries)
  8. 466268Domain d1ep6c_: 1ep6 C: [83191]

Details for d1ep6c_

PDB Entry: 1ep6 (more details), 2.45 Å

PDB Description: crystal structure of the conserved core domain of venezualan equine encephalitis capsid protein

SCOP Domain Sequences for d1ep6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep6c_ b.47.1.3 (C:) Viral capsid protein {Venezuelan equine encephalitis virus}
esdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleyadvpq
nmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvvaivl
ggvnegsrtalsvvmwnekgvtvkytpenceqw

SCOP Domain Coordinates for d1ep6c_:

Click to download the PDB-style file with coordinates for d1ep6c_.
(The format of our PDB-style files is described here.)

Timeline for d1ep6c_: