SCOP 1.73: Domain d1ep5b_: 1ep5 B:

Lineage for d1ep5b_ (1ep5 B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Venezuelan equine encephalitis virus [TaxId:11036] [89347] (2 PDB entries)

8. Domain d1ep5b_: 1ep5 B: [83187]

Details for d1ep5b_

PDB Entry: 1ep5, 2.3 Å

PDB Description: crystal structure of the conserved core domain of venezualan equine encephalitis capsid protein

PDB Compounds: (B:) capsid protein c

SCOP Domain Sequences for d1ep5b_:

Sequence; same for both SEQRES and ATOM records:

>d1ep5b_ b.47.1.3 (B:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]}
vmklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleya
dvpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvv
aivlggvnegsrtalsvvmwnekgvtvkytpenceqw

Timeline for d1ep5b_:

• d1ep5b_ first appeared in SCOP 1.65
  
• d1ep5b_ appears in SCOP 1.71
  
• d1ep5b_ appears in SCOP 1.75
  
• d1ep5b_ appears in the current release, SCOPe 2.08