SCOPe 2.07: Domain d1ep5a_: 1ep5 A:

Lineage for d1ep5a_ (1ep5 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Venezuelan equine encephalitis virus [TaxId:11036] [89347] (2 PDB entries)

8. Domain d1ep5a_: 1ep5 A: [83186]
   complexed with so4, ure

Details for d1ep5a_

PDB Entry: 1ep5, 2.3 Å

PDB Description: crystal structure of the conserved core domain of venezualan equine encephalitis capsid protein

PDB Compounds: (A:) capsid protein c

SCOPe Domain Sequences for d1ep5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]}
mklesdktfpimlegkingyacvvggklfrpmhvegkidndvlaalktkkaskydleyad
vpqnmradtfkythekpqgyyswhhgavqyengrftvpkgvgakgdsgrpildnqgrvva
ivlggvnegsrtalsvvmwnekgvtvkytpenceqw

Timeline for d1ep5a_:

• d1ep5a_ first appeared in SCOP 1.65
  
• d1ep5a_ appears in SCOPe 2.06
  
• d1ep5a_ appears in the current release, SCOPe 2.08