SCOP 1.71: Domain d1ejxb_: 1ejx B:

Lineage for d1ejxb_ (1ejx B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1ejxb_: 1ejx B: [83183]
   Other proteins in same PDB: d1ejxa_, d1ejxc1, d1ejxc2
   complexed with kcx, ni

Details for d1ejxb_

PDB Entry: 1ejx, 1.6 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 100k

SCOP Domain Sequences for d1ejxb_:

Sequence; same for both SEQRES and ATOM records:

>d1ejxb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1ejxb_:

• d1ejxb_ first appeared in SCOP 1.65
  
• d1ejxb_ appears in SCOP 1.69
  
• d1ejxb_ appears in SCOP 1.73
  
• d1ejxb_ appears in the current release, SCOPe 2.08