Lineage for d1ejxb_ (1ejx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2817976Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2817977Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. 2817978Protein Urease, beta-subunit [51280] (4 species)
  7. 2818006Species Klebsiella aerogenes [TaxId:28451] [51281] (28 PDB entries)
  8. 2818007Domain d1ejxb_: 1ejx B: [83183]
    Other proteins in same PDB: d1ejxa_, d1ejxc1, d1ejxc2
    complexed with ni

Details for d1ejxb_

PDB Entry: 1ejx (more details), 1.6 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 100k
PDB Compounds: (B:) urease beta subunit

SCOPe Domain Sequences for d1ejxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejxb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOPe Domain Coordinates for d1ejxb_:

Click to download the PDB-style file with coordinates for d1ejxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ejxb_: