Lineage for d1ejxa_ (1ejx A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324865Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 324866Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family) (S)
  5. 324867Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)
  6. 324868Protein Urease, gamma-subunit [54113] (3 species)
  7. 324878Species Klebsiella aerogenes [TaxId:28451] [54114] (26 PDB entries)
  8. 324879Domain d1ejxa_: 1ejx A: [83182]
    Other proteins in same PDB: d1ejxb_, d1ejxc1, d1ejxc2
    complexed with kcx, ni

Details for d1ejxa_

PDB Entry: 1ejx (more details), 1.6 Å

PDB Description: crystal structure of wild-type klebsiella aerogenes urease at 100k

SCOP Domain Sequences for d1ejxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejxa_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOP Domain Coordinates for d1ejxa_:

Click to download the PDB-style file with coordinates for d1ejxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ejxa_: