Lineage for d1eeza2 (1eez A:1-181)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326714Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 326717Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (30 PDB entries)
  8. 326744Domain d1eeza2: 1eez A:1-181 [83177]
    Other proteins in same PDB: d1eeza1, d1eezb_, d1eezd1, d1eeze_

Details for d1eeza2

PDB Entry: 1eez (more details), 2.3 Å

PDB Description: crystal structure determination of hla-a2.1 complexed to gp2 peptide variant(i2l/v5l)

SCOP Domain Sequences for d1eeza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1eeza2:

Click to download the PDB-style file with coordinates for d1eeza2.
(The format of our PDB-style files is described here.)

Timeline for d1eeza2: