SCOP 1.65: Domain d1eeza1: 1eez A:182-275

Lineage for d1eeza1 (1eez A:182-275)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)

8. Domain d1eeza1: 1eez A:182-275 [83176]
   Other proteins in same PDB: d1eeza2, d1eezb_, d1eezd2, d1eeze_

Details for d1eeza1

PDB Entry: 1eez, 2.3 Å

PDB Description: crystal structure determination of hla-a2.1 complexed to gp2 peptide variant(i2l/v5l)

SCOP Domain Sequences for d1eeza1:

Sequence; same for both SEQRES and ATOM records:

>d1eeza1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1eeza1:

• d1eeza1 is new in SCOP 1.65
  
• d1eeza1 appears in SCOP 1.67
  
• d1eeza1 appears in the current release, SCOPe 2.08