Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) |
Domain d1eeyd1: 1eey D:182-275 [83173] Other proteins in same PDB: d1eeya2, d1eeyb_, d1eeyd2, d1eeye_ mutant |
PDB Entry: 1eey (more details), 2.25 Å
SCOP Domain Sequences for d1eeyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeyd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1eeyd1:
View in 3D Domains from other chains: (mouse over for more information) d1eeya1, d1eeya2, d1eeyb_, d1eeye_ |