SCOPe 2.01: Domain d1eeya2: 1eey A:1-181

Lineage for d1eeya2 (1eey A:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
   Uniprot P01892 25-298

8. Domain d1eeya2: 1eey A:1-181 [83171]
   Other proteins in same PDB: d1eeya1, d1eeyb_, d1eeyd1, d1eeye_

Details for d1eeya2

PDB Entry: 1eey, 2.25 Å

PDB Description: crystal structure determination of hla a2 complexed to peptide gp2 with the substitution (i2l/v5l/l9v)

PDB Compounds: (A:) hla-a2.1 MHC class I (heavy chain)

SCOPe Domain Sequences for d1eeya2:

Sequence; same for both SEQRES and ATOM records:

>d1eeya2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1eeya2:

• d1eeya2 first appeared in SCOP 1.65
  
• d1eeya2 appears in SCOP 1.75
  
• d1eeya2 appears in SCOPe 2.02
  
• d1eeya2 appears in the current release, SCOPe 2.08