Lineage for d1eeya2 (1eey A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937782Domain d1eeya2: 1eey A:1-181 [83171]
    Other proteins in same PDB: d1eeya1, d1eeyb_, d1eeyd1, d1eeye_

Details for d1eeya2

PDB Entry: 1eey (more details), 2.25 Å

PDB Description: crystal structure determination of hla a2 complexed to peptide gp2 with the substitution (i2l/v5l/l9v)
PDB Compounds: (A:) hla-a2.1 MHC class I (heavy chain)

SCOPe Domain Sequences for d1eeya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eeya2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1eeya2:

Click to download the PDB-style file with coordinates for d1eeya2.
(The format of our PDB-style files is described here.)

Timeline for d1eeya2: