Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries) Uniprot P01892 25-298 |
Domain d1eeya2: 1eey A:1-181 [83171] Other proteins in same PDB: d1eeya1, d1eeyb_, d1eeyd1, d1eeye_ |
PDB Entry: 1eey (more details), 2.25 Å
SCOPe Domain Sequences for d1eeya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeya2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1eeya2:
View in 3D Domains from other chains: (mouse over for more information) d1eeyb_, d1eeyd1, d1eeyd2, d1eeye_ |