Lineage for d1e1h.2 (1e1h C:,D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529351Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (29 PDB entries)
    Uniprot P10845 1-419
  8. 2529361Domain d1e1h.2: 1e1h C:,D: [83168]
    catalytic domain only; cleaved
    complexed with zn

Details for d1e1h.2

PDB Entry: 1e1h (more details), 1.8 Å

PDB Description: crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
PDB Compounds: (C:) botulinum neurotoxin type a light chain, (D:) botulinum neurotoxin type a light chain

SCOPe Domain Sequences for d1e1h.2:

Sequence, based on SEQRES records: (download)

>g1e1h.2 d.92.1.7 (C:,D:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
fspdftfgfeeslevdtnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvnt
nayXyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigt
taslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrkty
lnfdkavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrl

Sequence, based on observed residues (ATOM records): (download)

>g1e1h.2 d.92.1.7 (C:,D:) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnayXyems
glevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttaslqymk
nvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfdkavf
rinivpdenytikdgfnlkanlstnfngqnteinsrnftrl

SCOPe Domain Coordinates for d1e1h.2:

Click to download the PDB-style file with coordinates for d1e1h.2.
(The format of our PDB-style files is described here.)

Timeline for d1e1h.2: