Lineage for d1e1h.1 (1e1h A:,B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 331986Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 331987Protein Botulinum neurotoxin [55513] (2 species)
  7. 331988Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (2 PDB entries)
  8. 331989Domain d1e1h.1: 1e1h A:,B: [83167]

Details for d1e1h.1

PDB Entry: 1e1h (more details), 1.8 Å

PDB Description: crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.

SCOP Domain Sequences for d1e1h.1:

Sequence, based on SEQRES records: (download)

>g1e1h.1 d.92.1.7 (A:,B:) Botulinum neurotoxin {Clostridium botulinum, serotype A}
maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
fspdftfgfeeslevdtnpllgagkfatdpavtlahelihaehrlygiainpnrvfkvnt
nayXemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigtt
aslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktyl
nfdkavfrinivpdenytikdgfnlkganlstnfngqnteinsrnftrl

Sequence, based on observed residues (ATOM records): (download)

>g1e1h.1 d.92.1.7 (A:,B:) Botulinum neurotoxin {Clostridium botulinum, serotype A}
maykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnpppeakq
vpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtel
kvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghdvlnltrngygstqyir
fspdftfgfeeslgagkfatdpavtlahelihaehrlygiainpnrvfkvntnayXemsg
levsfeelrtfgghdakfidslqenefrlyyynkfkdvastlnkaksiigttaslqymkn
vfkekyllsedtsgkfsvdklkfdklykmlteiytednfvnffkvinrktylnfdkavfr
inivpdenytikdgfnlkanlstnfngqnteinsrnftrl

SCOP Domain Coordinates for d1e1h.1:

Click to download the PDB-style file with coordinates for d1e1h.1.
(The format of our PDB-style files is described here.)

Timeline for d1e1h.1: