SCOPe 2.02: Domain d1cqsa_: 1cqs A:

Lineage for d1cqsa_ (1cqs A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (35 PDB entries)
   Uniprot P07445

8. Domain d1cqsa_: 1cqs A: [83165]
   complexed with equ; mutant

Details for d1cqsa_

PDB Entry: 1cqs, 1.9 Å

PDB Description: crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida

PDB Compounds: (A:) protein : ketosteroid isomerase

SCOPe Domain Sequences for d1cqsa_:

Sequence, based on SEQRES records:

>d1cqsa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvievmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records):

>d1cqsa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gkvracltgpvrashngcgampfrvemvwngqpcaldvievmrfdehgriqtmqaywsev
nlsv

Timeline for d1cqsa_:

• d1cqsa_ first appeared in SCOP 1.65
  
• d1cqsa_ appears in SCOPe 2.01
  
• d1cqsa_ appears in SCOPe 2.03
  
• d1cqsa_ appears in the current release, SCOPe 2.08