Lineage for d1cqsa_ (1cqs A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020129Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1020130Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1020181Species Pseudomonas putida [TaxId:303] [54437] (31 PDB entries)
    Uniprot P07445
  8. 1020222Domain d1cqsa_: 1cqs A: [83165]
    complexed with equ; mutant

Details for d1cqsa_

PDB Entry: 1cqs (more details), 1.9 Å

PDB Description: crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida
PDB Compounds: (A:) protein : ketosteroid isomerase

SCOPe Domain Sequences for d1cqsa_:

Sequence, based on SEQRES records: (download)

>d1cqsa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvievmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d1cqsa_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gkvracltgpvrashngcgampfrvemvwngqpcaldvievmrfdehgriqtmqaywsev
nlsv

SCOPe Domain Coordinates for d1cqsa_:

Click to download the PDB-style file with coordinates for d1cqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cqsa_: