SCOPe 2.06: Domain d1c80b_: 1c80 B:

Lineage for d1c80b_ (1c80 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
   bifunctional enzyme

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)

8. Domain d1c80b_: 1c80 B: [83163]
   complexed with gtp, po4

Details for d1c80b_

PDB Entry: 1c80, 2.2 Å

PDB Description: regulatory complex of fructose-2,6-bisphosphatase

PDB Compounds: (B:) fructose-2,6-bisphosphatase

SCOPe Domain Sequences for d1c80b_:

Sequence; same for both SEQRES and ATOM records:

>d1c80b_ c.60.1.4 (B:) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mrsiylcrhgeselnlrgriggdsglsargkqyayalanfirsqgisslkvwtshmkrti
qtaealgvpyeqwkalneidagvceemtyeeiqehypeefalrdqdkyryrypkgesyed
lvqrlepvimelerqenvlvichqavmrcllayfldkssdelpylkcplhtvlkltpvay
gcrvesiylnv

Timeline for d1c80b_:

• d1c80b_ first appeared in SCOP 1.65
  
• d1c80b_ appears in SCOPe 2.05
  
• d1c80b_ appears in SCOPe 2.07
  
• d1c80b_ appears in the current release, SCOPe 2.08