Lineage for d1b4pa2 (1b4p A:1-84)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (14 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) 
Protein Class mu GST [81359] (3 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries) 
Domain d1b4pa2: 1b4p A:1-84 [83159]
Other proteins in same PDB: d1b4pa1
chimeric isozyme
complexed with gps, so4
Details for d1b4pa2
PDB Entry: 1b4p (more details), 1.7 Å
PDB Description: crystal structures of class mu chimeric gst isoenzymes m1-2 and m2-1
SCOP Domain Sequences for d1b4pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4pa2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh
SCOP Domain Coordinates for d1b4pa2:
Click to download the PDB-style file with coordinates for d1b4pa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b4pa2:
- d1b4pa2 first appeared in SCOP 1.65
- d1b4pa2 appears in SCOP 1.69
- d1b4pa2 appears in the current release, SCOPe 2.08
View in 3D
