Lineage for d1b4pa1 (1b4p A:85-217)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) 
Protein Class mu GST [81348] (3 species) Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries) 
Domain d1b4pa1: 1b4p A:85-217 [83158]
Other proteins in same PDB: d1b4pa2
chimeric isoenzyme
complexed with gps, so4
Details for d1b4pa1
PDB Entry: 1b4p (more details), 1.7 Å
PDB Description: crystal structures of class mu chimeric gst isoenzymes m1-2 and m2-1
SCOP Domain Sequences for d1b4pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4pa1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeerirvdvlenqamdtrlqlamvcyspdferkkpeyleglpekmklyseflgkq
pwfagnkityvdflvydvldqhrifepkcldafpnlkdfvarfeglkkisdymksgrfls
kpifakmafwnpk
SCOP Domain Coordinates for d1b4pa1:
Click to download the PDB-style file with coordinates for d1b4pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b4pa1:
- d1b4pa1 is new in SCOP 1.65
- d1b4pa1 appears in SCOP 1.67
- d1b4pa1 appears in the current release, SCOPe 2.08
View in 3D
