Lineage for d1b2g.1 (1b2g B:,A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 341324Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 341325Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 341326Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 341331Protein Insulin [56996] (3 species)
  7. 341492Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 341513Domain d1b2g.1: 1b2g B:,A: [83157]

Details for d1b2g.1

PDB Entry: 1b2g (more details), 1.8 Å

PDB Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 9.00 coordinates)

SCOP Domain Sequences for d1b2g.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b2g.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa)}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1b2g.1:

Click to download the PDB-style file with coordinates for d1b2g.1.
(The format of our PDB-style files is described here.)

Timeline for d1b2g.1: