Lineage for d1b2f.1 (1b2f B:,A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029798Domain d1b2f.1: 1b2f B:,A: [83156]

Details for d1b2f.1

PDB Entry: 1b2f (more details), 1.9 Å

PDB Description: ph affects glu b13 switching and sulfate binding in cubic insulin crystals (ph 6.98 coordinates)
PDB Compounds: (A:) PROTEIN (INSULIN A chain), (B:) PROTEIN (INSULIN b chain)

SCOPe Domain Sequences for d1b2f.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1b2f.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1b2f.1:

Click to download the PDB-style file with coordinates for d1b2f.1.
(The format of our PDB-style files is described here.)

Timeline for d1b2f.1: