| Class g: Small proteins [56992] (100 folds) |
| Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) ![]() |
| Family g.1.1.1: Insulin-like [56995] (5 proteins) |
| Protein Insulin [56996] (3 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries) |
| Domain d1b2c.1: 1b2c B:,A: [83153] complexed with so4 |
PDB Entry: 1b2c (more details), 1.8 Å
SCOPe Domain Sequences for d1b2c.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1b2c.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkaXgiveqcctsicslyqlenycn
Timeline for d1b2c.1: