SCOPe 2.05: Domain d1tmf.1: 1tmf 4:,2:

Lineage for d1tmf.1 (1tmf 4:,2:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Theilovirus capsid proteins [49686] (1 species)

7. Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries)

8. Domain d1tmf.1: 1tmf 4:,2: [83124]

Details for d1tmf.1

PDB Entry: 1tmf, 3.5 Å

PDB Description: three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)

PDB Compounds: (2:) theiler's murine encephalomyelitis virus (subunit vp2), (4:) theiler's murine encephalomyelitis virus (subunit vp4)

SCOPe Domain Sequences for d1tmf.1:

Sequence, based on SEQRES records:

>g1tmf.1 b.121.4.1 (4:,2:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da [TaxId: 12124]}
nesgnegviinnfysnqyqnsidlsasggnagdapqtngqlsnllXdqnteemenlsdrv
asdkagnsatntqstvgrlcgygkshhgehpascadtatdkvlaaeryytidlaswttsq
eafshiriplphvlagedggvfgatlrrhylcktgwrvqvqcnasqfhagsllvfmapef
ytgkgtktgtmepsdpftmdtewrspqgaptgyrydsrtgffatnhqnqwqwtvyphqil
nlrtnttvdlevpyvnvapssswtqhanwtlvvavlsplqyatgsspdvqitaslqpvnp
vfnglrhetviaq

Sequence, based on observed residues (ATOM records):

>g1tmf.1 b.121.4.1 (4:,2:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da [TaxId: 12124]}
nesgnegviinnfysnqyqnsidlsalsnllXdqnteemenlsdrvasdkagnsatntqs
tvgrlcgygkshhgehpascadtatdkvlaaeryytidlaswttsqeafshiriplphvl
agedggvfgatlrrhylcktgwrvqvqcnasqfhagsllvfmapefytgkgtktgtmeps
dpftmdtewrspqgaptgyrydsrtgffatnhqnqwqwtvyphqilnlrtnttvdlevpy
vnvapssswtqhanwtlvvavlsplqyatgsspdvqitaslqpvnpvfnglrhetviaq

Timeline for d1tmf.1:

• d1tmf.1 first appeared in SCOP 1.65
  
• d1tmf.1 appears in SCOPe 2.04
  
• d1tmf.1 appears in SCOPe 2.06
  
• d1tmf.1 appears in the current release, SCOPe 2.08