SCOPe 2.07: Domain d1pvc.1: 1pvc 4:,2:

Lineage for d1pvc.1 (1pvc 4:,2:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Poliovirus coat proteins [49666] (3 species)

7. Species Poliovirus type 3, strain Sabin [TaxId:12086] [49669] (7 PDB entries)

8. Domain d1pvc.1: 1pvc 4:,2: [83104]
   complexed with myr, sph

Details for d1pvc.1

PDB Entry: 1pvc, 2.4 Å

PDB Description: refinement of the sabin strain of type 3 poliovirus at 2.4 angstroms and the crystal structures of its variants at 2.9 angstroms resolution

PDB Compounds: (2:) poliovirus type 3, sabin strain, (4:) poliovirus type 3, sabin strain

SCOPe Domain Sequences for d1pvc.1:

Sequence, based on SEQRES records:

>g1pvc.1 b.121.4.1 (4:,2:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
gaqvssqkvgahensnrayggstinyttinyykdsasnaaskqdysqdpskfteplkdvl
iktapalnXacgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptep
dvatcrfytldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnask
fhqgalgvfaipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpv
dyllgcgvllgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspl
dfaqdssveipitvtiapmcsefnglrnvtapkfq

Sequence, based on observed residues (ATOM records):

>g1pvc.1 b.121.4.1 (4:,2:) Poliovirus coat proteins {Poliovirus type 3, strain Sabin [TaxId: 12086]}
gaqvssqkvgahensstinyttinyykdsasnaaskqdysqdpskfteplkdvliktapa
lnXacgysdrvlqltlgnstittqeaansvvaygrwpefirddeanpvdqptepdvatcr
fytldtvmwgkeskgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgal
gvfaipeyclagdsdkqrytsyananpgerggkfysqfnkdnavtspkrefcpvdyllgc
gvllgnafvyphqiinlrtnnsativlpyvnalaidsmvkhnnwgiailplspldfaqds
sveipitvtiapmcsefnglrnvtapkfq

Timeline for d1pvc.1:

• d1pvc.1 first appeared in SCOP 1.65
  
• d1pvc.1 appears in SCOPe 2.06
  
• d1pvc.1 appears in the current release, SCOPe 2.08