Lineage for d1ku2b1 (1ku2 B:273-332)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723765Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1723766Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1723767Protein Sigma factor SigA [88663] (1 species)
  7. 1723768Species Thermus aquaticus [TaxId:271] [88664] (1 PDB entry)
  8. 1723770Domain d1ku2b1: 1ku2 B:273-332 [83098]
    Other proteins in same PDB: d1ku2a2, d1ku2b2
    complexed with so4

Details for d1ku2b1

PDB Entry: 1ku2 (more details), 2.9 Å

PDB Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1
PDB Compounds: (B:) sigma factor sigA

SCOPe Domain Sequences for d1ku2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku2b1 a.4.13.1 (B:273-332) Sigma factor SigA {Thermus aquaticus [TaxId: 271]}
iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl

SCOPe Domain Coordinates for d1ku2b1:

Click to download the PDB-style file with coordinates for d1ku2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ku2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ku2b2