Lineage for d1k8wa4 (1k8w A:74-250)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329948Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 329956Family d.58.35.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 329957Protein Pseudouridine synthase II TruB [69747] (1 species)
  7. 329958Species Escherichia coli [TaxId:562] [69748] (1 PDB entry)
  8. 329960Domain d1k8wa4: 1k8w A:74-250 [83095]
    Other proteins in same PDB: d1k8wa3
    complexed with fhu, so4; mutant

Details for d1k8wa4

PDB Entry: 1k8w (more details), 1.85 Å

PDB Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA

SCOP Domain Sequences for d1k8wa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8wa4 d.58.35.2 (A:74-250) Pseudouridine synthase II TruB {Escherichia coli}
kryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysalkyqg
kklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlgeklgc
gahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspasd

SCOP Domain Coordinates for d1k8wa4:

Click to download the PDB-style file with coordinates for d1k8wa4.
(The format of our PDB-style files is described here.)

Timeline for d1k8wa4:

  • d1k8wa4 is new in SCOP 1.65
  • d1k8wa4 does not appear in SCOP 1.67