Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Hypothetical protein TM1643 [75108] (1 species) |
Species Thermotoga maritima [TaxId:2336] [75109] (2 PDB entries) |
Domain d1j5pa4: 1j5p A:1-108,A:220-241 [83092] Other proteins in same PDB: d1j5pa3, d1j5pa5 complexed with nad |
PDB Entry: 1j5p (more details), 1.9 Å
SCOPe Domain Sequences for d1j5pa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5pa4 c.2.1.3 (A:1-108,A:220-241) Hypothetical protein TM1643 {Thermotoga maritima [TaxId: 2336]} mtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecaspea vkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgXsmltvysilrt lrnleskiifg
Timeline for d1j5pa4: